PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01003614001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 194aa    MW: 21352.1 Da    PI: 7.5997
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01003614001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.53.2e-3377133360
        ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                        k rY+eClkNhA+s+GghavDGCgEfm++ g+egt +alkCaAC+CHRnFHR+e+e e
  GSVIVT01003614001  77 KPRYRECLKNHAVSIGGHAVDGCGEFMAA-GAEGTLDALKCAACNCHRNFHRKEMEGE 133
                        679*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-2360131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.3E-3079130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.9E-3079130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.24380129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.4E-17132172IPR009057Homeodomain-like
SuperFamilySSF466893.29E-8133172IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MNCTAVPPHR PDHSTSRQSP FYGAVKIKTM SGKLMEFEDQ EEHEEEIGLP TSYDSFGNST  60
RVKMATSGGE GSPAPRKPRY RECLKNHAVS IGGHAVDGCG EFMAAGAEGT LDALKCAACN  120
CHRNFHRKEM EGERLGWRIQ KHDEAVVQQF CSETGVKRHV LKVWMHNNKH TLGLPTRHTL  180
QDALLVPGEP SSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-171321713675ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.96801e-166bud| fruit| inflorescence| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4457861e-155AM445786.1 Vitis vinifera contig VV78X220028.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003635057.13e-55PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9SB613e-30ZHD2_ARATH; Zinc-finger homeodomain protein 2
STRINGVIT_00s0199g00250.t019e-55(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65410.12e-28homeobox protein 25